Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG13 Rabbit Polyclonal Antibody (HRP)

ALG13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CDG1S, DEE36, EIEE36, MDS031, TDRD13, CXorf45, GLT28D1, YGL047W

UniProt

Q9NP73

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_060936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Serine/threonine protein kinase Sgk1 (SGK1) ELISA Kit
GTR10317284 96 Well

Canine Serine/threonine protein kinase Sgk1 (SGK1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal POTEG Antibody (OTI2G1) [DyLight 680]
NBP2-73540FR 0.1 mL

Mouse Monoclonal POTEG Antibody (OTI2G1) [DyLight 680]

Sign In for Pricing
View Details
ADAM10 Antibody, Biotin conjugated
A11898-100UG 100 µg

ADAM10 Antibody, Biotin conjugated

Sign In for Pricing
View Details
3- (6-Ethyl-thieno[2,3-d]pyrimidin-4-ylamino) -propionic acid
sc-310096 500 mg

3- (6-Ethyl-thieno[2,3-d]pyrimidin-4-ylamino) -propionic acid

Sign In for Pricing
View Details
RIPPLY1 3'UTR Luciferase Stable Cell Line
TU019940 1.0 mL

RIPPLY1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70)
AP74368 1 Each

Recombinant Alternaria alternata Heat shock 70KDA protein (HSP70)

Sign In for Pricing
View Details