Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBK Rabbit Polyclonal Antibody (HRP)

PBK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPK, CT84, TOPK, HEL164, Nori-3

UniProt

Q96KB5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PBK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF23 Antibody
DF8734-01 100 µL

ZNF23 Antibody

Sign In for Pricing
View Details
ZNF23 Antibody
DF8734-02 200 µL

ZNF23 Antibody

Sign In for Pricing
View Details
IL-1 alpha, human recombinant
4125-1000 1 mg

IL-1 alpha, human recombinant

Sign In for Pricing
View Details
Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband
MBS1754688-01 0.01 mg

Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband

Sign In for Pricing
View Details
Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband
MBS1754688-02 0.1 mg (Carrier Free)

Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband

Sign In for Pricing
View Details
Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband
MBS1754688-03 0.1 mg

Anti-Heme Oxygenase 1/Hmox1 Antibody Picoband

Sign In for Pricing
View Details