Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR1B Rabbit Polyclonal Antibody (HRP)

POLR1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A135, RPA2, TCS4, RPA135, Rpo1-2

UniProt

Q9H9Y6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

128kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP6 (NM_001936) Human Over-expression Lysate
LC419638 20 µg

DPP6 (NM_001936) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Hydroxypyrene beta-D-Glucuronide
TRC-H952750-5MG 5 mg

1-Hydroxypyrene beta-D-Glucuronide

Sign In for Pricing
View Details
CD7, AlpHcAbs® Human
HA710330 100 µg

CD7, AlpHcAbs® Human

Sign In for Pricing
View Details
QSER1 Human Gene Knockout Kit (CRISPR)
KN421102 1 Kit

QSER1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WASF2 Rabbit Monoclonal Antibody
TA422641 100 µL

WASF2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Nptx1 Rabbit Polyclonal Antibody
AP13991PU-N 400 µL

Nptx1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details