Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDSS2 Rabbit Polyclonal Antibody (FITC)

PDSS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DLP1, COQ1B, hDLP1, COQ10D3, C6orf210, bA59I9.3

UniProt

Q86YH6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PDSS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065114

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syce2 3'UTR Luciferase Stable Cell Line
TU119999 1.0 mL

Syce2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLC29A4 Antibody Blocking Peptide
orb1504451 500 µg

SLC29A4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Phospho-CDK2 (Thr160) Colorimetric Cell-Based ELISA Kit
MBS9501003-01 1 Kit

Phospho-CDK2 (Thr160) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-CDK2 (Thr160) Colorimetric Cell-Based ELISA Kit
MBS9501003-02 5x 1 Kit

Phospho-CDK2 (Thr160) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
HTR6/5-HT6 Receptor Antibody
orb1534337 50 µg

HTR6/5-HT6 Receptor Antibody

Sign In for Pricing
View Details
Lentiviral human ANK2 shRNA (UAS) - Lentiviral human ANK2 shRNA (UAS) (25)
GTR15307808 1 Vial

Lentiviral human ANK2 shRNA (UAS) - Lentiviral human ANK2 shRNA (UAS) (25)

Sign In for Pricing
View Details