Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trmt5 Rabbit Polyclonal Antibody (Biotin)

Trmt5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MKIAA1393, 2610027O18Rik

UniProt

Q9D0C4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TKVRENNYTYEFDFSKVYWNPRLSTEHGRITELLNPGDVLFDVFAGVGPF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (MaxLight 750) discontinued
132431-ML750 100 µL

RCC1 (Regulator of Chromosome Condensation, Chromosome Condensation Protein 1, Cell Cycle Regulatory Protein, RCC1, CHC1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
NUP133 Rabbit Polyclonal Antibody
orb412828-01 30 µL

NUP133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUP133 Rabbit Polyclonal Antibody
orb412828-02 50 μL

NUP133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUP133 Rabbit Polyclonal Antibody
orb412828-03 100 µL

NUP133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUP133 Rabbit Polyclonal Antibody
orb412828-04 200 µL

NUP133 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Hydroxytryptamine/serotonin (5HT/ST) Rabbit ELISA Kit
B1112 96 Tests

5-Hydroxytryptamine/serotonin (5HT/ST) Rabbit ELISA Kit

Sign In for Pricing
View Details