Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trmt5 Rabbit Polyclonal Antibody (HRP)

Trmt5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKIAA1393, 2610027O18Rik

UniProt

Q9D0C4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKVRENNYTYEFDFSKVYWNPRLSTEHGRITELLNPGDVLFDVFAGVGPF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMP3, CT (EMP3, YMP, Epithelial membrane protein 3, Hematopoietic neural membrane protein 1, Protein YMP) (MaxLight 490) discontinued
035065-ML490 100 µL

EMP3, CT (EMP3, YMP, Epithelial membrane protein 3, Hematopoietic neural membrane protein 1, Protein YMP) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Alcyne-FAM-TAT (47-57) conjugate
PP51074 0.5 mg

Alcyne-FAM-TAT (47-57) conjugate

Sign In for Pricing
View Details
Rabbit Anti Human DPYSL3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)
IRBAMLDPYSL3AP35200UL 1 Each

Rabbit Anti Human DPYSL3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA)

Sign In for Pricing
View Details
Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit
MBS9932204-01 48 Well

Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit

Sign In for Pricing
View Details
Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit
MBS9932204-02 96 Well

Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit

Sign In for Pricing
View Details
Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit
MBS9932204-03 5x 96 Well

Bovine Oxoeicosanoid Receptor 1 (OXER1) ELISA Kit

Sign In for Pricing
View Details