Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT5 Rabbit Polyclonal Antibody (FITC)

TRMT5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRM5, COXPD26, KIAA1393

UniProt

Q32P41

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRMT5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)
MBS6295642-01 0.1 mL

ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)

Sign In for Pricing
View Details
ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)
MBS6295642-02 5x 0.1 mL

ENOX2, NT (ENOX2, COVA1, Ecto-NOX disulfide-thiol exchanger 2, APK1 antigen, Cytosolic ovarian carcinoma antigen 1, Tumor-associated hydroquinone oxidase, Hydroquinone [NADH] oxidase, Protein disulfide-thiol oxidoreductase) (MaxLight 750)

Sign In for Pricing
View Details
B7-H3 (enoblituzumab biosimilar) mAb Antibody
orb1544139-01 50 µg

B7-H3 (enoblituzumab biosimilar) mAb Antibody

Sign In for Pricing
View Details
B7-H3 (enoblituzumab biosimilar) mAb Antibody
orb1544139-02 100 µg

B7-H3 (enoblituzumab biosimilar) mAb Antibody

Sign In for Pricing
View Details
Psmd4 sgRNA CRISPR Lentivector set (Rat)
K7001101 3x 1.0 µg

Psmd4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human C-Type Natriuretic Peptide (CNP) ELISA Kit
DLR-CNP-Hu-96T 96 Tests

Human C-Type Natriuretic Peptide (CNP) ELISA Kit

Sign In for Pricing
View Details