Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CROT Rabbit Polyclonal Antibody (Biotin)

CROT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COT

UniProt

Q9UKG9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CROT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt, phosphorylated (Ser473)
519971-01 100 µL

Akt, phosphorylated (Ser473)

Sign In for Pricing
View Details
Akt, phosphorylated (Ser473)
519971-02 200 µL

Akt, phosphorylated (Ser473)

Sign In for Pricing
View Details
Bovine Vitamin K1 (VK1) ELISA Kit
OM616995 96 Strip Well

Bovine Vitamin K1 (VK1) ELISA Kit

Sign In for Pricing
View Details
CSNK2B (CSNK2B, CK2N, G5A, Casein kinase II subunit beta, Phosvitin, Protein G5a) (Biotin)
MBS6121161-01 0.2 mL

CSNK2B (CSNK2B, CK2N, G5A, Casein kinase II subunit beta, Phosvitin, Protein G5a) (Biotin)

Sign In for Pricing
View Details
CSNK2B (CSNK2B, CK2N, G5A, Casein kinase II subunit beta, Phosvitin, Protein G5a) (Biotin)
MBS6121161-02 5x 0.2 mL

CSNK2B (CSNK2B, CK2N, G5A, Casein kinase II subunit beta, Phosvitin, Protein G5a) (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Prl8a2 shRNA (UAS) - Lentiviral mouse Prl8a2 shRNA (UAS, RFP) (25)
GTR15149183 1 Vial

Lentiviral mouse Prl8a2 shRNA (UAS) - Lentiviral mouse Prl8a2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details