Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CROT Rabbit Polyclonal Antibody (HRP)

CROT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COT

UniProt

Q9UKG9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CROT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066974

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCK1, NT (NCK1, NCK, Cytoplasmic protein NCK1, NCK adaptor protein 1, SH2/SH3 adaptor protein NCK-alpha)
038829 200 µL

NCK1, NT (NCK1, NCK, Cytoplasmic protein NCK1, NCK adaptor protein 1, SH2/SH3 adaptor protein NCK-alpha)

Sign In for Pricing
View Details
Olfactory receptor 8D1 discontinued
392566 200 µL

Olfactory receptor 8D1 discontinued

Sign In for Pricing
View Details
Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) ELISA Kit
RK10685 96 Tests

Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)
MBS1378828-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)
MBS1378828-02 0.02 mg (Yeast)

Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)
MBS1378828-03 0.1 mg (E-Coli)

Recombinant Coxiella burnetii Adenylosuccinate synthetase (purA)

Sign In for Pricing
View Details