Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI2 Rabbit Polyclonal Antibody (Biotin)

PELI2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9HAT8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PELI2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: STISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067078.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCBP2 Antibody
CSB-PA017517GA01HU 100 µL

PCBP2 Antibody

Sign In for Pricing
View Details
PCTAIRE1 Antibody
orb1319776 100 µg

PCTAIRE1 Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)
TRV-0040500-01 20 µL

Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details
Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)
TRV-0040500-02 100 µL

Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details
Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)
TRV-0040500-03 200 µL

Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details
Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)
TRV-0040500-04 1 mL

Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing
View Details