Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PELI2 Rabbit Polyclonal Antibody (HRP)

PELI2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9HAT8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PELI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMD

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067078.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prdx3 3'UTR Luciferase Stable Cell Line
TU116909 1.0 mL

Prdx3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
UGT2B15, ID (UGT2B15, UGT2B8, UDP-glucuronosyltransferase 2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGTh-3) (APC) discontinued
043583-APC 200 µL

UGT2B15, ID (UGT2B15, UGT2B8, UDP-glucuronosyltransferase 2B15, HLUG4, UDP-glucuronosyltransferase 2B8, UDPGTh-3) (APC) discontinued

Sign In for Pricing
View Details
C15orf59 ORF Vector (Human) (pORF)
ORF016436 1.0 µg DNA

C15orf59 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Thermo bath / cool block (acce : AB90-13)
AB90-13 1 Each

Thermo bath / cool block (acce : AB90-13)

Sign In for Pricing
View Details
POLA2 Rabbit Polyclonal Antibody (Biotin)
orb2089555 100 µL

POLA2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RPL36 Rabbit Polyclonal Antibody (PE)
orb2594165 100 µg

RPL36 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details