Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gmppb Rabbit Polyclonal Antibody (HRP)

Gmppb Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI317178, E430010H19

UniProt

Q8BTZ7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVIL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_808578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1F5 Peptide - middle region (AAP55628)
AAP55628-100UG 100 µg

IL1F5 Peptide - middle region (AAP55628)

Sign In for Pricing
View Details
TMF1 Rabbit pAb
E45R23789N-50 50 µL

TMF1 Rabbit pAb

Sign In for Pricing
View Details
Lunatic Fringe (LFNG) (NM_002304) Human Tagged ORF Clone
RG229769 10 µg

Lunatic Fringe (LFNG) (NM_002304) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse CCNY Protein, His (Fc)-Avi-tagged
CCNY-1416M 50 µg

Recombinant Mouse CCNY Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Caprisil NH2-D HPLC Column, 3 µm, 100 Å, CC533-AD x 150 mm
CC433-AD 3 µm

Caprisil NH2-D HPLC Column, 3 µm, 100 Å, CC533-AD x 150 mm

Sign In for Pricing
View Details
KLHL15 Human Over-expression Lysate
orb1371482 20 µg

KLHL15 Human Over-expression Lysate

Sign In for Pricing
View Details