Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN3 Rabbit Polyclonal Antibody (Biotin)

NSUN3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MST077, COXPD48, MSTP077

UniProt

Q9H649

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NSUN3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LPLLQIELLRSAIKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_071355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADD (Protein FADD, FAS-associated Death Domain Protein, FAS-associating Death Domain-containing Protein, Growth-inhibiting Gene 3 Protein, Mediator of Receptor Induced Toxicity, MORT1, GIG3) discontinued
F0019-52A 100 µg

FADD (Protein FADD, FAS-associated Death Domain Protein, FAS-associating Death Domain-containing Protein, Growth-inhibiting Gene 3 Protein, Mediator of Receptor Induced Toxicity, MORT1, GIG3) discontinued

Sign In for Pricing
View Details
MID1IP1 (MID1 Interacting Protein 1 (Gastrulation Specific G12 Homolog (zebrafish) ), FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL) (MaxLight 550)
248764-ML550 100 µL

MID1IP1 (MID1 Interacting Protein 1 (Gastrulation Specific G12 Homolog (zebrafish) ), FLJ10386, G12-like, MIG12, STRAIT11499, THRSPL) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Eotaxin 3 Antibody
MBS176799-01 0.01 mg

Anti-Eotaxin 3 Antibody

Sign In for Pricing
View Details
Anti-Eotaxin 3 Antibody
MBS176799-02 0.1 mg (Carrier Free)

Anti-Eotaxin 3 Antibody

Sign In for Pricing
View Details
Anti-Eotaxin 3 Antibody
MBS176799-03 0.1 mg

Anti-Eotaxin 3 Antibody

Sign In for Pricing
View Details
Anti-Eotaxin 3 Antibody
MBS176799-04 0.1 mg (Cy3)

Anti-Eotaxin 3 Antibody

Sign In for Pricing
View Details