Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mettl4 Rabbit Polyclonal Antibody (FITC)

Mettl4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HsT66, HsT661, AV296509, 2410198H06Rik, A730091E08Rik

UniProt

D3ZD59

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Brain-derived neurotrophic factor (BDNF) Antibody
R-083-100 100 µL

Anti-Brain-derived neurotrophic factor (BDNF) Antibody

Sign In for Pricing
View Details
TNFSF9 Polyclonal Antibody
E910202 100 µL

TNFSF9 Polyclonal Antibody

Sign In for Pricing
View Details
FAM36A (COX20) Human shRNA Plasmid Kit (Locus ID 116228)
TR319737 1 Kit

FAM36A (COX20) Human shRNA Plasmid Kit (Locus ID 116228)

Sign In for Pricing
View Details
Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)
orb1882037-01 20 µg

Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)

Sign In for Pricing
View Details
Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)
orb1882037-02 100 µg

Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)

Sign In for Pricing
View Details
Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)
orb1882037-03 1 mg

Recombinant Bovine Paraneoplastic antigen Ma1 homolog (PNMA1)

Sign In for Pricing
View Details