Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mettl4 Rabbit Polyclonal Antibody (HRP)

Mettl4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsT66, HsT661, AV296509, 2410198H06Rik, A730091E08Rik

UniProt

D3ZD59

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPCAM antibody(DM147), Rabbit mAb
TA389363 100 µg

Anti-EPCAM antibody(DM147), Rabbit mAb

Sign In for Pricing
View Details
RABL4 (IFT27) (NM_006860) Human 3' UTR Clone
SC200612 10 µg

RABL4 (IFT27) (NM_006860) Human 3' UTR Clone

Sign In for Pricing
View Details
KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL)
128874 50 µg

KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL)

Sign In for Pricing
View Details
SCAMP4 (C-term) Rabbit Polyclonal Antibody
AP23889PU-N 50 µg

SCAMP4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1110017D15Rik Protein Vector (Mouse) (pPB-C-His)
PV146318 500 ng

1110017D15Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Camel Dendritic Cell-Specific Intercellular Adhesion Molecule 3-Grabbing Non-Integrin ELISA Kit
MBS095486-01 48 Well

Camel Dendritic Cell-Specific Intercellular Adhesion Molecule 3-Grabbing Non-Integrin ELISA Kit

Sign In for Pricing
View Details