Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGS1 Rabbit Polyclonal Antibody (FITC)

PGS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZP762M186, MGC131960

UniProt

Q32NB8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGS1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAH25951

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synj2 (NM_011523) Mouse Tagged ORF Clone
MR218552 10 µg

Synj2 (NM_011523) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ezrin, phosphorylated (Y478)
328630-01 50 µg

Ezrin, phosphorylated (Y478)

Sign In for Pricing
View Details
Ezrin, phosphorylated (Y478)
328630-02 100 µg

Ezrin, phosphorylated (Y478)

Sign In for Pricing
View Details
CeraLysis, 2 x 50 ml tubes
lmd50-2 1 Unit

CeraLysis, 2 x 50 ml tubes

Sign In for Pricing
View Details
Olfr12 ORF Vector (Mouse) (pORF)
32660014 1.0 µg DNA

Olfr12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
EPB49, ID (EPB49, DMT, Dematin, Erythrocyte membrane protein band 4.9) (MaxLight 405)
MBS6295891-01 0.1 mL

EPB49, ID (EPB49, DMT, Dematin, Erythrocyte membrane protein band 4.9) (MaxLight 405)

Sign In for Pricing
View Details