Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NARG1L Rabbit Polyclonal Antibody (FITC)

NARG1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NARG1L

UniProt

B0QZ59

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NARG1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001104268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP6C Antibody, FITC conjugated
MBS7052295-01 0.05 mg

PPP6C Antibody, FITC conjugated

Sign In for Pricing
View Details
PPP6C Antibody, FITC conjugated
MBS7052295-02 0.1 mg

PPP6C Antibody, FITC conjugated

Sign In for Pricing
View Details
PPP6C Antibody, FITC conjugated
MBS7052295-03 5x 0.1 mg

PPP6C Antibody, FITC conjugated

Sign In for Pricing
View Details
CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (BSA & Azide Free) (FITC)
MBS6266426-01 0.1 mL

CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (BSA & Azide Free) (FITC)

Sign In for Pricing
View Details
CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (BSA & Azide Free) (FITC)
MBS6266426-02 5x 0.1 mL

CD38 (Acute Lymphoblastic Leukemia Cells Antigen, ADP Ribosyl Cyclase, CADPr Hydrolase 1, Cyclic ADP Ribose Hydrolase, Ecto Nicotinamide Adenine Dinucleotide Glycohydrolase, I19 (Mouse), Lymphocyte Differentiation Antigen) (BSA & Azide Free) (FITC)

Sign In for Pricing
View Details
Ketohexokinase Rabbit Monoclonal Antibody
E56G1242 100 µL

Ketohexokinase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details