Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QTRT2 Rabbit Polyclonal Antibody (FITC)

QTRT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Qrt, Qrtr2, Qtrtd, Qtrtd1, AI648807, 3110012M05Rik, 4930470H18Rik

UniProt

B8ZXI1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Qtrtd1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083404

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISO20560PM-135X500-BLEEKMIDDEL Pipe Markers for Acids & Bases
317471 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-135X500-BLEEKMIDDEL Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
IRGC, ID (Interferon-inducible GTPase 5, IRGC, IIGP5, IRGC1) (MaxLight 405) discontinued
037107-ML405 100 µL

IRGC, ID (Interferon-inducible GTPase 5, IRGC, IIGP5, IRGC1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LRIG2 Protein Vector (Human) (pPM-C-His)
PV054796 500 ng

LRIG2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit
MBS7260354-01 48 Well

Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit

Sign In for Pricing
View Details
Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit
MBS7260354-02 96 Well

Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit

Sign In for Pricing
View Details
Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit
MBS7260354-03 5x 96 Well

Goat Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (VMA21) ELISA Kit

Sign In for Pricing
View Details