Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTDC1 Rabbit Polyclonal Antibody (FITC)

GTDC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mat-Xa, Hmat-Xa

UniProt

B8ZZ45

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GTDC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_011510164.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KUM 32
T205343-01 10 mg

KUM 32

Sign In for Pricing
View Details
KUM 32
T205343-02 50 mg

KUM 32

Sign In for Pricing
View Details
Goat Anti-Chicken IgG Antibody (H+L), AbBy Fluor™ 555 Conjugated
bs-0310G-BF555 200 µL

Goat Anti-Chicken IgG Antibody (H+L), AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Probable ubiquinone biosynthesis protein UbiB (ubiB), partial
MBS7100305 Inquire

Recombinant Neisseria meningitidis serogroup A / serotype 4A Probable ubiquinone biosynthesis protein UbiB (ubiB), partial

Sign In for Pricing
View Details
IGHA1 Rabbit Monoclonal Antibody [Clone ID: RM124]
TA398676 50 µg

IGHA1 Rabbit Monoclonal Antibody [Clone ID: RM124]

Sign In for Pricing
View Details
PRK1 (phospho-Thr774) /PRK2 (phospho-Thr816) rabbit pAb
E28PP1451 100 µL

PRK1 (phospho-Thr774) /PRK2 (phospho-Thr816) rabbit pAb

Sign In for Pricing
View Details