Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTDC1 Rabbit Polyclonal Antibody (HRP)

GTDC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mat-Xa, Hmat-Xa

UniProt

B8ZZ45

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human GTDC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_011510164.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRNP Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-11788R-BF750-TR 20 µL

PRNP Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
NDN sgRNA CRISPR Lentivector (Human) (Target 1)
K1406802 1.0 µg DNA

NDN sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CYP26C1 Recombinant Protein (Human)
RP053880 100 µg

CYP26C1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rabbit IgG (H+L) Secondary Antibody [DyLight 650] (Pre-adsorbed)
NBP1-76078 1 mg

Goat Polyclonal Goat anti-Rabbit IgG (H+L) Secondary Antibody [DyLight 650] (Pre-adsorbed)

Sign In for Pricing
View Details
Dbn1 3'UTR GFP Stable Cell Line
TU154863 1.0 mL

Dbn1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ANO3/TMEM16C Antibody
E55A15156 100 µg

ANO3/TMEM16C Antibody

Sign In for Pricing
View Details