Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECHDC3 Rabbit Polyclonal Antibody (HRP)

ECHDC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RP11-401F24.3, FLJ20909

UniProt

Q96DC8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ECHDC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW86340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP2 (NM_000597) Human Over-expression Lysate
LS003485 100 µg

IGFBP2 (NM_000597) Human Over-expression Lysate

Sign In for Pricing
View Details
TIMP3 Recombinant Protein
OPCD07463-200UG 200 µg

TIMP3 Recombinant Protein

Sign In for Pricing
View Details
Bmi-1 Rabbit Polyclonal Antibody (F270)
BT-AP14458-01 20 µL

Bmi-1 Rabbit Polyclonal Antibody (F270)

Sign In for Pricing
View Details
Bmi-1 Rabbit Polyclonal Antibody (F270)
BT-AP14458-02 50 µL

Bmi-1 Rabbit Polyclonal Antibody (F270)

Sign In for Pricing
View Details
Bmi-1 Rabbit Polyclonal Antibody (F270)
BT-AP14458-03 100 µL

Bmi-1 Rabbit Polyclonal Antibody (F270)

Sign In for Pricing
View Details
AP2M1 (NM_001025205) Human Tagged ORF Clone
RG201377 10 µg

AP2M1 (NM_001025205) Human Tagged ORF Clone

Sign In for Pricing
View Details