Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa40 Rabbit Polyclonal Antibody (Biotin)

Naa40 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Nat, NatD, Nat11, AU023197, 4931433E08Rik

UniProt

Q8VE10

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naa40

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSQHSHTGGHCGGCCH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)
CSB-EP850687DOA-01 20 µg

Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)
CSB-EP850687DOA-02 100 µg

Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)
CSB-EP850687DOA-03 1 mg

Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2C (DREB2C)

Sign In for Pricing
View Details
Glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate
LH02779V 100 µg

Glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Hemopexin
MBS143111-01 0.01 mg

Human Hemopexin

Sign In for Pricing
View Details
Human Hemopexin
MBS143111-02 0.05 mg

Human Hemopexin

Sign In for Pricing
View Details