Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa40 Rabbit Polyclonal Antibody (HRP)

Naa40 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nat, NatD, Nat11, AU023197, 4931433E08Rik

UniProt

Q8VE10

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naa40

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSQHSHTGGHCGGCCH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BUD13, CT (BUD13, BUD13 homolog) (MaxLight 550)
MBS6279337-01 0.1 mL

BUD13, CT (BUD13, BUD13 homolog) (MaxLight 550)

Sign In for Pricing
View Details
BUD13, CT (BUD13, BUD13 homolog) (MaxLight 550)
MBS6279337-02 5x 0.1 mL

BUD13, CT (BUD13, BUD13 homolog) (MaxLight 550)

Sign In for Pricing
View Details
CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)
MBS6467948-01 0.1 mL

CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)

Sign In for Pricing
View Details
CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)
MBS6467948-02 5x 0.1 mL

CD5L (CD5 Antigen-like, CD5 Molecule-like, AIM, API6, CT-2, IgM-associated Peptide, PRO229, SPalpha, SP-alpha) (MaxLight 650)

Sign In for Pricing
View Details
THAL-SNS-032
C13835-100mg 100 mg

THAL-SNS-032

Sign In for Pricing
View Details
EpCAM Recombinant monoclonal antibody (EGP40/1555R)
ENZ-ABS364-0100 100 µg

EpCAM Recombinant monoclonal antibody (EGP40/1555R)

Sign In for Pricing
View Details