Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK11 Rabbit Polyclonal Antibody (HRP)

NEK11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NEK11

UniProt

Q8NG66

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NEK11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO2B (NM_001190457) Human Over-expression Lysate
LY434260 100 µg

CORO2B (NM_001190457) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF2S2 Rabbit Polyclonal Antibody
TA365794 100 µL

EIF2S2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stromal interaction molecuLe 1 (STIM1) (NM_003156) Human Over-expression Lysate
LY401099 100 µg

Stromal interaction molecuLe 1 (STIM1) (NM_003156) Human Over-expression Lysate

Sign In for Pricing
View Details
R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate
LY400684 100 µg

R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate

Sign In for Pricing
View Details
AASS Rabbit Polyclonal Antibody
AP12425PU-N 400 µL

AASS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details