Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf34 Rabbit Polyclonal Antibody (Biotin)

CXorf34 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CXorf34, dJ341D10.3

UniProt

Q96GJ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CXorf34

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPGWSQLFLGTVCKGDFTRVIATKCQKGQKSQKKPSHLGPLDGSWQERLA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cotton Rat IL-6 MAb (Clone 147135)
MAB561 500 µg

Cotton Rat IL-6 MAb (Clone 147135)

Sign In for Pricing
View Details
SH2D6 sgRNA CRISPR Lentivector (Human) (Target 2)
K2139503 1.0 µg DNA

SH2D6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat anti-G2s antibody IgG (Anti-G2s IgG) ELISA Kit
EIA07116r 1 Kit

Rat anti-G2s antibody IgG (Anti-G2s IgG) ELISA Kit

Sign In for Pricing
View Details
Goose Laminin Alpha 1 ELISA Kit
MBS084211 Inquire

Goose Laminin Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Caskin2 Pre-designed siRNA Set B
SI101826B 1 Each

Mouse Caskin2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human CCR1 Alexa Fluor 700 Antibody (Clone 53504)
FAB145N-100UG 100 µg

Human CCR1 Alexa Fluor 700 Antibody (Clone 53504)

Sign In for Pricing
View Details