Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf34 Rabbit Polyclonal Antibody (Biotin)

CXorf34 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CXorf34, dJ341D10.3

UniProt

Q96GJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXorf34

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MXI1 Human Gene Knockout Kit (CRISPR)
KN402332 1 Kit

MXI1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OSGIN2 Mouse Monoclonal Antibody [Clone ID: OTI6E10]
CF808945 100 µg

OSGIN2 Mouse Monoclonal Antibody [Clone ID: OTI6E10]

Sign In for Pricing
View Details
Ranbp9 Mouse Gene Knockout Kit (CRISPR)
KN514461 1 Kit

Ranbp9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ephrin B2 Recombinant Rabbit monoclonal Antibody
HA750428 100 µL

Ephrin B2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Anti-PIP2;1, PIP2;2, PIP2;3 | Plasma membrane intrinistic protein 2-1, 2-2, 2-3
AS22 4810 50 µg

Anti-PIP2;1, PIP2;2, PIP2;3 | Plasma membrane intrinistic protein 2-1, 2-2, 2-3

Sign In for Pricing
View Details
XLF Recombinant Rabbit Monoclonal Antibody [PSH01-07]
HA721572 100 µL

XLF Recombinant Rabbit Monoclonal Antibody [PSH01-07]

Sign In for Pricing
View Details