Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf34 Rabbit Polyclonal Antibody (HRP)

CXorf34 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CXorf34, dJ341D10.3

UniProt

Q96GJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXorf34

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MiTF Monoclonal Antibody
AN301081L-01 50 µL

Recombinant MiTF Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant MiTF Monoclonal Antibody
AN301081L-02 100 µL

Recombinant MiTF Monoclonal Antibody

Sign In for Pricing
View Details
Human ITK activation kit by CRISPRa
GA102490 1 Kit

Human ITK activation kit by CRISPRa

Sign In for Pricing
View Details
Squalene Epoxidase (SQLE) (NM_003129) Human Over-expression Lysate
LY418884 100 µg

Squalene Epoxidase (SQLE) (NM_003129) Human Over-expression Lysate

Sign In for Pricing
View Details
Trit1 Mouse Gene Knockout Kit (CRISPR)
KN518255 1 Kit

Trit1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-1 beta/IL1B, C-His Tag
HA210576-01 20 µg

Human IL-1 beta/IL1B, C-His Tag

Sign In for Pricing
View Details