Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT13 Rabbit Polyclonal Antibody (Biotin)

NAT13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SAN, MAK3, NAT5, NAT13, NAT5P, NAT13P, hNaa50p

UniProt

Q9GZZ1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NAT13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M/M018/EN285-ALU05-120X50/1-B AC Signs
302772 Pack of 1 Pictogram(s)

M/M018/EN285-ALU05-120X50/1-B AC Signs

Sign In for Pricing
View Details
Factor I light chain Rabbit Polyclonal Antibody (BF405)
orb2441058 100 µL

Factor I light chain Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Rat Kl (Klotho) QuickTest ELISA Kit
MBS7620033-01 48 Well

Rat Kl (Klotho) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat Kl (Klotho) QuickTest ELISA Kit
MBS7620033-02 96 Well

Rat Kl (Klotho) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat Kl (Klotho) QuickTest ELISA Kit
MBS7620033-03 5x 96 Well

Rat Kl (Klotho) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat Kl (Klotho) QuickTest ELISA Kit
MBS7620033-04 10x 96 Well

Rat Kl (Klotho) QuickTest ELISA Kit

Sign In for Pricing
View Details