Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD7 Rabbit Polyclonal Antibody (HRP)

SETD7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KMT7, SET7, SET9, SET7/9

UniProt

Q8WTS6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SETD7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGK

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_085151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein 7, Brain (FABP7) BioAssayTM ELISA Kit (Mouse)
365997 96 Tests

Fatty Acid Binding Protein 7, Brain (FABP7) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
BECN1 siRNA (Rat)
CRR2860-01 15 nmol

BECN1 siRNA (Rat)

Sign In for Pricing
View Details
BECN1 siRNA (Rat)
CRR2860-02 30 nmol

BECN1 siRNA (Rat)

Sign In for Pricing
View Details
LOC683221 3'UTR GFP Stable Cell Line
TU260948 1.0 mL

LOC683221 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ethyl 2-benzylacetoacetate
FE22967-01 0.05 kg

Ethyl 2-benzylacetoacetate

Sign In for Pricing
View Details
Ethyl 2-benzylacetoacetate
FE22967-02 0.1 Kg

Ethyl 2-benzylacetoacetate

Sign In for Pricing
View Details