Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT4 Rabbit Polyclonal Antibody (Biotin)

B3GNT4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B3GN-T4, beta3Gn-T4

UniProt

Q9C0J1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_110392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bombesin (BN, Gastrin Releasing Peptide, Gastrin-releasing Peptide, GRP, Neuromedin C, Neuromedin-C, Pre-progastrin Releasing Peptide, PreproGRP, ProGRP) (AP) discontinued
B2550-05-AP 100 µL

Bombesin (BN, Gastrin Releasing Peptide, Gastrin-releasing Peptide, GRP, Neuromedin C, Neuromedin-C, Pre-progastrin Releasing Peptide, PreproGRP, ProGRP) (AP) discontinued

Sign In for Pricing
View Details
RT1-CE3 Protein Vector (Rat) (pPM-C-His)
PV302793 500 ng

RT1-CE3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Canine Neuregulin-1 (NRG1)
AP2F273 50 µg

Recombinant Canine Neuregulin-1 (NRG1)

Sign In for Pricing
View Details
Mouse E-Cadherin/CDH1/Cadherin-1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)
EZ0562 5 Plates/Kit

Mouse E-Cadherin/CDH1/Cadherin-1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
Rabbit UBE2A (Ubiquitin Conjugating Enzyme E2A) ELISA Kit
MBS2501131-01 24 Tests

Rabbit UBE2A (Ubiquitin Conjugating Enzyme E2A) ELISA Kit

Sign In for Pricing
View Details
Rabbit UBE2A (Ubiquitin Conjugating Enzyme E2A) ELISA Kit
MBS2501131-02 48 Tests

Rabbit UBE2A (Ubiquitin Conjugating Enzyme E2A) ELISA Kit

Sign In for Pricing
View Details