Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT4 Rabbit Polyclonal Antibody (HRP)

B3GNT4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B3GN-T4, beta3Gn-T4

UniProt

Q9C0J1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_110392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Viper Venom protein Rabbit Polyclonal Antibody (BF750)
orb2454453 100 µL

Viper Venom protein Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Anxa13 3'UTR GFP Stable Cell Line
TU151884 1.0 mL

Anxa13 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit
MBS8804563-01 48 Well

Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit

Sign In for Pricing
View Details
Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit
MBS8804563-02 96 Well

Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit

Sign In for Pricing
View Details
Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit
MBS8804563-03 5x 96 Well

Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit

Sign In for Pricing
View Details
Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit
MBS8804563-04 10x 96 Well

Human CYP2C19 (Cytochrome P450 2C19) ELISA Kit

Sign In for Pricing
View Details