Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TKTL2 Rabbit Polyclonal Antibody (Biotin)

TKTL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP434L1717, FLJ32975

UniProt

Q9H0I9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TKTL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPD1P3 Recombinant Protein (Human)
RP063717 100 µg

HSPD1P3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit
MBS2513239-01 24 Tests

Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit
MBS2513239-02 48 Tests

Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit
MBS2513239-03 96 Tests

Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit
MBS2513239-04 5x 96 Tests

Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit
MBS2513239-05 10x 96 Tests

Chicken CABIN1 (Calcineurin Binding Protein 1) ELISA Kit

Sign In for Pricing
View Details