Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TKTL2 Rabbit Polyclonal Antibody (HRP)

TKTL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZP434L1717, FLJ32975

UniProt

Q9H0I9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TKTL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115512

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 Peptide
AF0863-BP 1 mg

Histone H3 Peptide

Sign In for Pricing
View Details
Cd53 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3370705 3x 1.0 µg

Cd53 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rsph1 Mouse shRNA Plasmid (Locus ID 22092)
TL502339 1 Kit

Rsph1 Mouse shRNA Plasmid (Locus ID 22092)

Sign In for Pricing
View Details
cDNA - Rat Normal Tissue: Stomach
C1434248 40 Reactions

cDNA - Rat Normal Tissue: Stomach

Sign In for Pricing
View Details
LTβR CRISPR Activation Plasmid (h2)
sc-402774-ACT-2 20 µg

LTβR CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
MAST205 (MAST2) Human shRNA Lentiviral Particle (Locus ID 23139)
TL311565V 500 µL Each

MAST205 (MAST2) Human shRNA Lentiviral Particle (Locus ID 23139)

Sign In for Pricing
View Details