Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACS Rabbit Polyclonal Antibody (HRP)

PHACS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACS, PHACS

UniProt

Q96QU6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHACS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW68073

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R8 (Nuclear inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, Activator of RNA Decay, ARD-1, PPP1R8, ARD1, NIPP1)
406933-01 50 µL

PPP1R8 (Nuclear inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, Activator of RNA Decay, ARD-1, PPP1R8, ARD1, NIPP1)

Sign In for Pricing
View Details
PPP1R8 (Nuclear inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, Activator of RNA Decay, ARD-1, PPP1R8, ARD1, NIPP1)
406933-02 100 µL

PPP1R8 (Nuclear inhibitor of Protein Phosphatase 1, NIPP-1, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, Activator of RNA Decay, ARD-1, PPP1R8, ARD1, NIPP1)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)
MBS1433874-01 0.02 mg (E-Coli)

Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)
MBS1433874-02 0.1 mg (E-Coli)

Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)
MBS1433874-03 0.02 mg (Yeast)

Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)
MBS1433874-04 0.1 mg (Yeast)

Recombinant Mycobacterium paratuberculosis Peptide deformylase (def)

Sign In for Pricing
View Details