Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POMGNT2 Rabbit Polyclonal Antibody (FITC)

POMGNT2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AGO61, GTDC2, MDDGA8, MDDGC8, C3orf39

UniProt

Q8NAT1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C3orf39

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116195

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CX3CR1 Antibody Fluoro488 Conjugated
A00280-2-Fluoro488 100 µg/Vial

Anti-CX3CR1 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Pump Tube Tygon® F-4040-A, 380mm, 3 tabs: blue-blue
1606511 12 PK

Pump Tube Tygon® F-4040-A, 380mm, 3 tabs: blue-blue

Sign In for Pricing
View Details
Troponin I, cardiac muscle, PHOSPHORYLATED (Cardiac Troponin I, TNNI3, TNNC1)
T8665-18M 200 µg

Troponin I, cardiac muscle, PHOSPHORYLATED (Cardiac Troponin I, TNNI3, TNNC1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial
MBS1105216-01 0.5 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial
MBS1105216-02 0.05 mg (Baculovirus)

Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial
MBS1105216-03 0.5 mg (Yeast)

Recombinant Saccharomyces cerevisiae Synaptobrevin homolog 2 (SNC2), partial

Sign In for Pricing
View Details