Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCMTD1 Rabbit Polyclonal Antibody (HRP)

PCMTD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ10883

UniProt

Q96MG8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCMTD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P95/NBS1 (Phospho-Ser343) Rabbit mAb
RDSA65083 100 µL

P95/NBS1 (Phospho-Ser343) Rabbit mAb

Sign In for Pricing
View Details
Mouse Anti-Porcine Neuronal Pentraxin 2 (NPTX2) Monoclonal Antibody
VD10N83 1 Each

Mouse Anti-Porcine Neuronal Pentraxin 2 (NPTX2) Monoclonal Antibody

Sign In for Pricing
View Details
Rat Arl9 Pre-designed siRNA Set B
SI200939B 1 Each

Rat Arl9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Hsa-miR-4722-5p miRNA Antagomir
orb1914741-01 10 nmol

Hsa-miR-4722-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4722-5p miRNA Antagomir
orb1914741-02 20 nmol

Hsa-miR-4722-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Clostridium thermocellum Phosphopantetheine adenylyltransferase (coaD)
MBS1210548-01 0.02 mg (E-Coli)

Recombinant Clostridium thermocellum Phosphopantetheine adenylyltransferase (coaD)

Sign In for Pricing
View Details