Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGM7 Rabbit Polyclonal Antibody (HRP)

TGM7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TGMZ

UniProt

Q96PF1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TGM7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit
MBS9308399-01 48 Well

Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit
MBS9308399-02 96 Well

Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit
MBS9308399-03 5x 96 Well

Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit
MBS9308399-04 10x 96 Well

Mouse Receptor II For The Fc Region Of Immunoglobulin E (FceRII) ELISA Kit

Sign In for Pricing
View Details
Bcat1 (NM_001024468) Mouse Tagged Lenti ORF Clone
MR218043L4 10 µg

Bcat1 (NM_001024468) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Feline Panleukopenia Virus Antigen/Feline Coronavirus Antigen/Feline Giardiasis Antigen (FeliD-3 Ag) Rapid Test Kit (FPV/FCoV/GIA Ag)
HG031 10 Tests/Kit

Feline Panleukopenia Virus Antigen/Feline Coronavirus Antigen/Feline Giardiasis Antigen (FeliD-3 Ag) Rapid Test Kit (FPV/FCoV/GIA Ag)

Sign In for Pricing
View Details