Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT6 Rabbit Polyclonal Antibody (FITC)

B3GNT6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BGnT-6, B3Gn-T6, beta3Gn-T6, beta-1,3-Gn-T6

UniProt

Q6ZMB0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human B3GNT6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFB Polyclonal Antibody
E-AB-67412-01 60 µL

VEGFB Polyclonal Antibody

Sign In for Pricing
View Details
VEGFB Polyclonal Antibody
E-AB-67412-02 120 µL

VEGFB Polyclonal Antibody

Sign In for Pricing
View Details
VEGFB Polyclonal Antibody
E-AB-67412-03 200 µL

VEGFB Polyclonal Antibody

Sign In for Pricing
View Details
Slit Homolog 1 (Slit1) BioAssayTM ELISA Kit (Rat)
028103 96 Tests

Slit Homolog 1 (Slit1) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Klrh1 shRNA (UAS) - Lentiviral mouse Klrh1 shRNA (UAS, iRFP) (25)
GTR15132146 1 Vial

Lentiviral mouse Klrh1 shRNA (UAS) - Lentiviral mouse Klrh1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
HSP27 Rabbit Polyclonal Antibody (BF594)
orb1607805 100 µL

HSP27 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details