Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT6 Rabbit Polyclonal Antibody (FITC)

B3GNT6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BGnT-6, B3Gn-T6, beta3Gn-T6, beta-1,3-Gn-T6

UniProt

Q6ZMB0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human B3GNT6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC-SIGNR1/CD209b Polyclonal Antibody FITC Conjugated
orb1540700 100 µL

DC-SIGNR1/CD209b Polyclonal Antibody FITC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD100
MBS8537091-01 0.1 mL

Mouse Monoclonal Antibody to CD100

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD100
MBS8537091-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to CD100

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD100
MBS8537091-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to CD100

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD100
MBS8537091-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to CD100

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CD100
MBS8537091-05 0.1 mL (AF635)

Mouse Monoclonal Antibody to CD100

Sign In for Pricing
View Details