Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNPLA5 Rabbit Polyclonal Antibody (HRP)

PNPLA5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GS2L, dJ388M5, dJ388M5.4

UniProt

Q7Z6Z6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PNPLA5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_620169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IgG (H+L) - 50nm Gold Conjugate
AC-50-02-05 0.5 mL

Anti-Mouse IgG (H+L) - 50nm Gold Conjugate

Sign In for Pricing
View Details
Mouse Interferon Regulatory Factor 5 (IRF5) ELISA Kit
orb1948820-01 48 Tests

Mouse Interferon Regulatory Factor 5 (IRF5) ELISA Kit

Sign In for Pricing
View Details
Mouse Interferon Regulatory Factor 5 (IRF5) ELISA Kit
orb1948820-02 96 Tests

Mouse Interferon Regulatory Factor 5 (IRF5) ELISA Kit

Sign In for Pricing
View Details
ADAM1 3'UTR GFP Stable Cell Line
TU050288 1.0 mL

ADAM1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PCDHAC1 Rabbit pAb
MBS8559956-01 0.1 mL

PCDHAC1 Rabbit pAb

Sign In for Pricing
View Details
PCDHAC1 Rabbit pAb
MBS8559956-02 0.1 mL (AF405L)

PCDHAC1 Rabbit pAb

Sign In for Pricing
View Details