Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC16 Rabbit Polyclonal Antibody (HRP)

TTC16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ32780, RP11-56D16.6

UniProt

Q8NEE8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TTC16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_659402

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Uroporphyrinogen III Synthase (UROS) ELISA Kit
orb1662912-01 48 Tests

Human Uroporphyrinogen III Synthase (UROS) ELISA Kit

Sign In for Pricing
View Details
Human Uroporphyrinogen III Synthase (UROS) ELISA Kit
orb1662912-02 96 Tests

Human Uroporphyrinogen III Synthase (UROS) ELISA Kit

Sign In for Pricing
View Details
Human TSR3 Knockout A549 cell line
GTR15410799 1 Vial

Human TSR3 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit
MBS9317541-01 48 Well

Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit

Sign In for Pricing
View Details
Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit
MBS9317541-02 96 Well

Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit

Sign In for Pricing
View Details
Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit
MBS9317541-03 5x 96 Well

Mouse G2/M phase-specific E3 ubiquitin-protein ligase, G2E3 ELISA Kit

Sign In for Pricing
View Details