Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map2k5 Rabbit Polyclonal Antibody (HRP)

Map2k5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEK5, Mapkk5, Prkmk5, AI324775, AI428457

UniProt

Q9WVS7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTVYKAHHVPSGKI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH13 Rabbit pAb
orb2712991-01 50 µL

MYH13 Rabbit pAb

Sign In for Pricing
View Details
MYH13 Rabbit pAb
orb2712991-02 100 µL

MYH13 Rabbit pAb

Sign In for Pricing
View Details
Human Vascuoar endothelial cell growth factor receptor 2 (VEGFR-2/Flk-1) ELISA Kit
QY-E00704 96 Tests

Human Vascuoar endothelial cell growth factor receptor 2 (VEGFR-2/Flk-1) ELISA Kit

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) Antibody
orb1461007-01 20 µg

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) Antibody

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) Antibody
orb1461007-02 100 µg

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) Antibody

Sign In for Pricing
View Details
Anti-CACNG6 Rabbit pAb
GB114902 100 μL

Anti-CACNG6 Rabbit pAb

Sign In for Pricing
View Details