Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT7 Rabbit Polyclonal Antibody (Biotin)

B3GNT7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Beta3GnT7

UniProt

Q8NFL0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA polymerase alpha Rabbit Polyclonal Antibody (PE)
orb496533 100 µL

DNA polymerase alpha Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) ELISA Kit
YP-W22727-01 48 Tests

Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) ELISA Kit

Sign In for Pricing
View Details
Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) ELISA Kit
YP-W22727-02 96 Tests

Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1) ELISA Kit

Sign In for Pricing
View Details
IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (AP) discontinued
128469-AP 100 µL

IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral human PTCHD4 sgRNA gene knockout kit - Lentiviral human PTCHD4 sgRNA gene knockout kit (100)
GTR15359671 1 Vial

Lentiviral human PTCHD4 sgRNA gene knockout kit - Lentiviral human PTCHD4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
IGFBP2 Rabbit Polyclonal Antibody (BF750)
orb2547738 100 µL

IGFBP2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details