Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT7 Rabbit Polyclonal Antibody (Biotin)

B3GNT7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Beta3GnT7

UniProt

Q8NFL0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (MaxLight 405)
MBS6192739-01 0.1 mL

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (MaxLight 405)

Sign In for Pricing
View Details
SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (MaxLight 405)
MBS6192739-02 5x 0.1 mL

SMNDC1 (Survival Motor Neuron Domain-containing Protein 1, 30kD Splicing Factor SMNrp, SMN-related Protein, SMNR, Survival of Motor Neuron-related-splicing Factor 30, SPF30) (MaxLight 405)

Sign In for Pricing
View Details
C6, NT (Complement Component C6) (MaxLight 550) discontinued
C7850-35G-ML550 100 µL

C6, NT (Complement Component C6) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Versilic stoppers, 18 x 21 x 25 mm Sales unit = 100 pieces
1211226 100 / PCK

Versilic stoppers, 18 x 21 x 25 mm Sales unit = 100 pieces

Sign In for Pricing
View Details
SSC5D, ID (SSC5D, Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, Soluble scavenger protein with 5 SRCR domains) (AP) discontinued
042324-AP 200 µL

SSC5D, ID (SSC5D, Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, Soluble scavenger protein with 5 SRCR domains) (AP) discontinued

Sign In for Pricing
View Details
Xanomeline Impurity 8
RM-X011308-01 10 mg

Xanomeline Impurity 8

Sign In for Pricing
View Details