Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3gnt7 Rabbit Polyclonal Antibody (Biotin)

B3gnt7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Beta-3Gn, beta-3GnT7, C330001H22Rik

UniProt

Q8K0J2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660257

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANBA (Beta-mannosidase, Lysosomal beta A Mannosidase, Mannanase, Mannase, MANB1) (FITC)
129349-FITC 100 µL

MANBA (Beta-mannosidase, Lysosomal beta A Mannosidase, Mannanase, Mannase, MANB1) (FITC)

Sign In for Pricing
View Details
Recombinant Anti-OSMR Antibody, Rabbit Monoclonal
MBS8105106-01 0.02 mL

Recombinant Anti-OSMR Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-OSMR Antibody, Rabbit Monoclonal
MBS8105106-02 0.1 mL

Recombinant Anti-OSMR Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-OSMR Antibody, Rabbit Monoclonal
MBS8105106-03 5x 0.1 mL

Recombinant Anti-OSMR Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Rabbit anti Dog IgG (heavy and light chains), conjugated with Horseradish peroxidase
MBS571169-01 1 mL

Rabbit anti Dog IgG (heavy and light chains), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details
Rabbit anti Dog IgG (heavy and light chains), conjugated with Horseradish peroxidase
MBS571169-02 5x 1 mL

Rabbit anti Dog IgG (heavy and light chains), conjugated with Horseradish peroxidase

Sign In for Pricing
View Details