Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3gnt7 Rabbit Polyclonal Antibody (HRP)

B3gnt7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta-3Gn, beta-3GnT7, C330001H22Rik

UniProt

Q8K0J2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660257

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100048884 siRNA Oligos set (Mouse)
26946174 3x 5 nmol

LOC100048884 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
1-Butylpyridinium triflate
IL-0182-HP-0100 100 g

1-Butylpyridinium triflate

Sign In for Pricing
View Details
ANLN Rabbit Polyclonal Antibody
E300503 100 µg - 200 µL

ANLN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GNE-049 10mg
A20206-10 10 mg

GNE-049 10mg

Sign In for Pricing
View Details
Goat Coagulation Factor IX ELISA kit
GTR10440686 96 Well

Goat Coagulation Factor IX ELISA kit

Sign In for Pricing
View Details
Lentiviral human COX6A2 sgRNA gene knockout kit - Lentiviral human COX6A2 sgRNA gene knockout kit (100)
GTR15381844 1 Vial

Lentiviral human COX6A2 sgRNA gene knockout kit - Lentiviral human COX6A2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details