Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3gnt7 Rabbit Polyclonal Antibody (HRP)

B3gnt7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta-3Gn, beta-3GnT7, C330001H22Rik

UniProt

Q8K0J2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660257

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALB2 Recombinant Rabbit mAb, APC conjugated
orb2349797 100 µL

CALB2 Recombinant Rabbit mAb, APC conjugated

Sign In for Pricing
View Details
Lentiviral mouse Sirt7 shRNA (UAS) - Lentiviral mouse Sirt7 shRNA (UAS, RFP) (100)
GTR15265464 1 Vial

Lentiviral mouse Sirt7 shRNA (UAS) - Lentiviral mouse Sirt7 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse Lipocalin-2/NGAL MAb (Clone 228418)
MAB1857-500 500 µg

Mouse Lipocalin-2/NGAL MAb (Clone 228418)

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF594 conjugate, 0.1mg/mL
BNC941907-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCAT1 Recombinant Protein
OPCD00196-200UG 200 µg

BCAT1 Recombinant Protein

Sign In for Pricing
View Details
ALDH1B1 Antibody
42-612 0.1 mg

ALDH1B1 Antibody

Sign In for Pricing
View Details