Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGD3 Rabbit Polyclonal Antibody (Biotin)

TIGD3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6B0B8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIGD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NKEKLLADWCSGTANRERKRKRESKYSGIDEALLCWYHIARAKAWDVTGP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663771

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HS90A ELISA Kit
E103319 1 Each

Human HS90A ELISA Kit

Sign In for Pricing
View Details
1-Butyl-2,3-dimethylimidazolium chloride
IL-0056-HP-1000 1 Kg

1-Butyl-2,3-dimethylimidazolium chloride

Sign In for Pricing
View Details
Human Olfactory receptor 51D1 (OR51D1) ELISA kit
GTR10474516 96 Well

Human Olfactory receptor 51D1 (OR51D1) ELISA kit

Sign In for Pricing
View Details
CXXC4 (NM_025212) Human Over-expression Lysate
LC410836 20 µg

CXXC4 (NM_025212) Human Over-expression Lysate

Sign In for Pricing
View Details
GFRA4, ID (GFRA4, GDNF family receptor alpha-4, Persephin receptor) (MaxLight 650)
MBS6302014-01 0.1 mL

GFRA4, ID (GFRA4, GDNF family receptor alpha-4, Persephin receptor) (MaxLight 650)

Sign In for Pricing
View Details
GFRA4, ID (GFRA4, GDNF family receptor alpha-4, Persephin receptor) (MaxLight 650)
MBS6302014-02 5x 0.1 mL

GFRA4, ID (GFRA4, GDNF family receptor alpha-4, Persephin receptor) (MaxLight 650)

Sign In for Pricing
View Details