Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOST, Human (Biotinylated, HEK293, His-Avi)

SOST proteins act as potent inhibitors of bone growth by effectively inhibiting Wnt signaling and subsequent bone formation. SOST exerts its inhibitory effect by interacting with key Wnt pathway components, including LRP4, LRP5, and LRP6. SOST Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived SOST protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Product Specifications

Product Name Alternative

SOST Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sost-protein-human-biotinylated-hek293-his-avi.html

Purity

95.00

Smiles

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Molecular Formula

50964 (Gene_ID) Q9BQB4-1 (Q24-Y213) (Accession)

Molecular Weight

28-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL
BNC741062-100 1x 100 µL

FSH beta (FSHb/1062), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL
BNC472400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL
BNC680685-500 1x 500 µL

CD68 (C68/684 + KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details