Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYK5 Rabbit Polyclonal Antibody (HRP)

LYK5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LYK5, PMSE, Stlk, STRAD, NY-BR-96, STRAD alpha

UniProt

Q7RTN6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LYK5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001003786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MSH6 Antibody (R3M87)
RHE93107 100 μg

Anti-MSH6 Antibody (R3M87)

Sign In for Pricing
View Details
Hist1h2aa sgRNA CRISPR Lentivector (Rat) (Target 2)
K6904103 1.0 µg DNA

Hist1h2aa sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CDK8 Rabbit Polyclonal Antibody (Fluoro488)
orb3113856 100 µg

CDK8 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
TAK1 (MAP3K7) (NM_003188) Human Tagged Lenti ORF Clone
RC204454L4 10 µg

TAK1 (MAP3K7) (NM_003188) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal DOG1/TMEM16A Antibody (DG1/1484) [DyLight 755]
NBP2-54492IR 100 µL

Mouse Monoclonal DOG1/TMEM16A Antibody (DG1/1484) [DyLight 755]

Sign In for Pricing
View Details
Tnfrsf18 3'UTR GFP Stable Cell Line
TU272236 1.0 mL

Tnfrsf18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details